Sema 25 mg

Sema is a synthetic analog of human glucagon-like peptide-1 (GLP-1), an incretin peptide released by the gut. The analog carries amino-acid substitutions and an attached fatty di-acid chain that slow its enzymatic breakdown relative to native GLP-1, and it is widely used as a long-acting reference agonist in non-clinical metabolic research.

This listing is the 25 mg vial. Each vial contains 25 mg of lyophilized Sema; the 2 mg, 5 mg, 10 mg, 15 mg and 20 mg sizes are listed separately.

Note: Sema is for research use only. Not for human consumption.

Sema Mechanism of Action (Based on Research)

The GLP-1 receptor pharmacology of the analog is the best-characterized part of its behavior in non-clinical models. The observations below are the ones most frequently reported in the published literature.

GLP-1 Receptor Agonism

Sema binds the GLP-1 receptor, a class B G-protein-coupled receptor. Receptor occupancy is followed by adenylate cyclase activation and a rise in intracellular cAMP, and that cAMP readout is the standard in vitro measure used to characterize the analog against native GLP-1 in cell-based assays.

Islet and Beta-Cell Models

In isolated pancreatic islets and beta-cell lines, GLP-1 receptor agonists are examined under glucose-dependent conditions, meaning the secretory response is observed only when extracellular glucose is elevated. Sema is a frequent comparator compound in those assays.

Albumin Binding and Circulating Half-Life

The fatty di-acid chain attached to the peptide backbone binds serum albumin. Pharmacokinetic studies in animal models describe slower renal clearance and a longer circulating half-life than native GLP-1 as a consequence of that binding, which is the property the modification was engineered to produce.

Food Intake and Body-Weight Endpoints in Rodent Models

Rodent studies record food intake and body-weight measures after exposure to GLP-1 receptor agonists, alongside markers of gastric emptying. These endpoints are the ones most often reported in the non-clinical literature on this compound class.

Sema Research Applications

Sema is used as a tool compound in GLP-1 receptor pharmacology, incretin signaling studies, islet and beta-cell culture work, and rodent metabolic-research models. It also serves as the single-agonist reference point in comparisons with the dual and triple incretin analogs Tirz and Reta. The 25 mg vial is the high-content size, intended where a study design consumes more material than the smaller vials cover.

Sema Peptide Characteristics

• Compound Class: acylated GLP-1 receptor agonist (peptide analog)
• Amino Acid Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG, carrying chemical modifications to the backbone and an attached fatty di-acid chain
• CAS Number: 910463-68-2
• Synonyms:
  • GLP-1(7-37) analog
  • NN9535
• Appearance: white lyophilized powder
• Vial Contents: 25 mg lyophilized powder
• Other Sizes Available: 2 mg, 5 mg, 10 mg, 15 mg and 20 mg vials, listed separately
• Storage Recommendations:
  • Lyophilized powder: store at -4 °F (-20 °C) for long-term storage (stable for up to 3 years); short-term storage at 39 °F (4 °C) (up to 2 years). Keep sealed, dry, and away from light.
  • In solution: store at 39 °F (4 °C) for short periods, or at -4 °F (-20 °C) for longer durations. Avoid repeated freeze-thaw cycles. Use sterile technique when handling.

Certificate of Analysis (COA)

Every vial of Sema offered by Evolve Peptides comes with a Certificate of Analysis (COA) to verify its identity, purity, and quality. These certificates are based on independent third-party testing, ensuring that each batch exceeds 99% purity and meets stringent analytical criteria for research applications.

Our COAs typically include:

• Purity analysis (e.g., HPLC or mass spectrometry)
• Identity confirmation
• Batch number and production date
• Storage conditions and solubility notes

You can access a sample COA PDF on each product page or request the specific COA for your batch after purchase. This documentation supports transparency and gives researchers confidence in the consistency and integrity of our products.

Legal Disclaimer

This product is intended strictly for laboratory research purposes only. It is not approved by the FDA or any other regulatory agency for human consumption, medical use, or veterinary application.

• • Not for diagnostic, therapeutic, or clinical use.
  • Not intended for resale or use in food, drugs, cosmetics, or household items.
• Not intended for ingestion, injection, or application to humans or animals, and should never be used in any form of self-experimentation.

By purchasing from Evolve Peptides, the buyer agrees to use it in accordance with all applicable laws, regulations, and research safety protocols.